Recombinant Human PTPN4 Protein

Recombinant Human PTPN4 Protein
SKU
ASBPP-4406-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P29074

Gene Name: PTPN4

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Phe321

End Site: Ile510

Coverage: 0.21

Isoelectric Point: 9.5

Core Sequence: FAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPSKPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHYSHSQQDLESHINETFDIPSSPEKPTPNGGI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Tyrosine-protein phosphatase non-receptor type 4; Protein-tyrosine phosphatase MEG1; MEG; PTPase-MEG1

Protein name: protein tyrosine phosphatase non-receptor type 4

Full length: 926 amino acids

Entry name: PTN4_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4406-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4406-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5775
Product information (PDF)
×
MSDS (PDF)
×