Note: Dry Ice fees will be extra-charged
Uniprot: Q12913
Gene Name: PTPRJ
Expression System: Escherichia coli
Molecular Weight: 52 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: N-SUMO & N-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 95%
Start Site: Lys1001
End Site: Gly1330
Coverage: 0.26
Isoelectric Point: 7
Core Sequence: KDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 47%, Pig - 97%, Cynomolgus monkey - 100%
Alternative gene names: DEP1
Alternative protein names: Receptor-type tyrosine-protein phosphatase eta; Protein-tyrosine phosphatase eta; R-PTP-eta; Density-enhanced phosphatase 1; DEP-1; HPTP eta; Protein-tyrosine phosphatase receptor type J; R-PTP-J; CD antigen CD148
Protein name: protein tyrosine phosphatase receptor type J
Full length: 1337 amino acids
Entry name: PTPRJ_HUMAN
CD Antigen: CD148
Product panel: CD Antigen,Enzyme