Recombinant Human PTPRN2 Protein

Recombinant Human PTPRN2 Protein
SKU
ASBPP-346-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92932

Gene Name: PTPRN2

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 51%

Start Site: Thr451

End Site: Val530

Coverage: 0.09

Isoelectric Point: 4.5

Core Sequence: TYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 51%, Rat - 54%, Pig - 49%, Cynomolgus monkey - 94%

Alternative gene names: KIAA0387

Alternative protein names: Receptor-type tyrosine-protein phosphatase N2; R-PTP-N2; Islet cell autoantigen-related protein; IAR; ICAAR; Phogrin) [Cleaved into: IA-2beta60]

Protein name: protein tyrosine phosphatase receptor type N2

Full length: 1015 amino acids

Entry name: PTPR2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-346-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-346-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5799
Product information (PDF)
×
MSDS (PDF)
×