Recombinant Human PYGM Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P11217

Gene Name: PYGM

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Val631

End Site: Arg740

Coverage: 0.13

Isoelectric Point: 4.5

Core Sequence: VNHDPAVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Glycogen phosphorylase; muscle form; Myophosphorylase

Protein name: glycogen phosphorylase, muscle associated

Full length: 842 amino acids

Entry name: PYGM_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4242-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4242-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5837