Note: Dry Ice fees will be extra-charged
Uniprot: P61106
Gene Name: RAB14
Expression System: Escherichia coli
Molecular Weight: 25 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 100%
Start Site: Met1
End Site: Cys215
Coverage: 1.00
Isoelectric Point: 6.5
Core Sequence: MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: /
Alternative protein names: Ras-related protein Rab-14
Protein name: RAB14, member RAS oncogene family
Full length: 215 amino acids
Entry name: RAB14_HUMAN