Note: Dry Ice fees will be extra-charged
Uniprot: O00194
Gene Name: RAB27B
Expression System: Escherichia coli
Molecular Weight: 25.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 94%
Start Site: Met1
End Site: Cys218
Coverage: 1.00
Isoelectric Point: 6.5
Core Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 94%, Cynomolgus monkey - 99%
Alternative gene names: /
Alternative protein names: Ras-related protein Rab-27B; C25KG
Protein name: RAB27B, member RAS oncogene family
Full length: 218 amino acids
Entry name: RB27B_HUMAN
Product panel: Enzyme