Recombinant Human Retinoic Acid Receptor alpha Protein

Recombinant Human Retinoic Acid Receptor alpha Protein
SKU
ASBPP-4369-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P10276

Gene Name: RARA

Expression System: Escherichia coli

Molecular Weight: 52 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Pro462

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 35%, Pig - 99%, Cynomolgus monkey - 98%

Alternative gene names: NR1B1

Alternative protein names: Retinoic acid receptor alpha; RAR-alpha; Nuclear receptor subfamily 1 group B member 1

Protein name: retinoic acid receptor alpha

Full length: 462 amino acids

Entry name: RARA_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4369-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4369-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5914
Product information (PDF)
×
MSDS (PDF)
×