Recombinant Human RBM3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P98179

Gene Name: RBM3

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Met1

End Site: Asn157

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 96%

Alternative gene names: RNPL

Alternative protein names: RNA-binding protein 3; RNA-binding motif protein 3; RNPL

Protein name: RNA binding motif protein 3

Full length: 157 amino acids

Entry name: RBM3_HUMAN

• SKU: ASBPP-3961-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3961-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5935