Recombinant Human RBM4B Protein

Recombinant Human RBM4B Protein
SKU
ASBPP-3651-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BQ04

Gene Name: RBM4B

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Arg11

End Site: Thr260

Coverage: 0.72

Isoelectric Point: 7

Core Sequence: REATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: RBM30

Alternative protein names: RNA-binding protein 4B; RNA-binding motif protein 30; RNA-binding motif protein 4B; RNA-binding protein 30

Protein name: RNA binding motif protein 4B

Full length: 359 amino acids

Entry name: RBM4B_HUMAN
More Information
SKU ASBPP-3651-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3651-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 83759
Product information (PDF)
×
MSDS (PDF)
×