Recombinant Human RBM8A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5S9

Gene Name: RBM8A

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Arg174

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: RBM8

Alternative protein names: RNA-binding protein 8A; Binder of OVCA1-1; BOV-1; RNA-binding motif protein 8A; RNA-binding protein Y14; Ribonucleoprotein RBM8A

Protein name: RNA binding motif protein 8A

Full length: 174 amino acids

Entry name: RBM8A_HUMAN

• SKU: ASBPP-3907-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3907-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9939