Recombinant Human RBPJ Protein

Recombinant Human RBPJ Protein
SKU
ASBPP-392-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q06330

Gene Name: RBPJ

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gly91

End Site: Lys170

Coverage: 0.19

Isoelectric Point: 9.5

Core Sequence: GCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: IGKJRB; IGKJRB1; RBPJK; RBPSUH

Alternative protein names: Recombining binding protein suppressor of hairless; CBF-1; J kappa-recombination signal-binding protein; RBP-J kappa; RBP-J; RBP-JK; Renal carcinoma antigen NY-REN-30

Protein name: recombination signal binding protein for immunoglobulin kappa J region

Full length: 500 amino acids

Entry name: SUH_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-392-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-392-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3516
Product information (PDF)
×
MSDS (PDF)
×