Recombinant Human RCOR2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IZ40

Gene Name: RCOR2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Asp201

End Site: Ser300

Coverage: 0.20

Isoelectric Point: 9

Core Sequence: DSDELEEGRGGVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQVQS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: REST corepressor 2

Protein name: REST corepressor 2

Full length: 523 amino acids

Entry name: RCOR2_HUMAN

• SKU: ASBPP-10436-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10436-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 283248