Recombinant Human RIPPLY3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P57055

Gene Name: RIPPLY3

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Leu51

End Site: Gly160

Coverage: 0.64

Isoelectric Point: 6

Core Sequence: LTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%

Alternative gene names: DSCR6

Alternative protein names: Protein ripply3; Down syndrome critical region protein 6

Protein name: ripply transcriptional repressor 3

Full length: 190 amino acids

Entry name: DSCR6_HUMAN

• SKU: ASBPP-3789-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3789-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 53820