Recombinant Human RPLP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P05387

Gene Name: RPLP2

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Asp115

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: D11S2243E; RPP2

Alternative protein names: Large ribosomal subunit protein P2; 60S acidic ribosomal protein P2; Renal carcinoma antigen NY-REN-44

Protein name: ribosomal protein lateral stalk subunit P2

Full length: 115 amino acids

Entry name: RLA2_HUMAN

Product panel: Autoimmune Disease

• SKU: ASBPP-3927-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3927-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6181