Recombinant Human RPS3A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P61247

Gene Name: RPS3A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Leu181

End Site: Val260

Coverage: 0.34

Isoelectric Point: 7

Core Sequence: LKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%

Alternative gene names: FTE1; MFTL

Alternative protein names: Small ribosomal subunit protein eS1; 40S ribosomal protein S3a; v-fos transformation effector protein; Fte-1

Protein name: ribosomal protein S3A

Full length: 264 amino acids

Entry name: RS3A_HUMAN

• SKU: ASBPP-3958-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3958-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6189