Recombinant Human RTN1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q16799

Gene Name: RTN1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Thr171

End Site: Thr300

Coverage: 0.18

Isoelectric Point: 4.5

Core Sequence: TPAESTEVNKILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 74%, Pig - 78%, Cynomolgus monkey - 97%

Alternative gene names: NSP

Alternative protein names: Reticulon-1; Neuroendocrine-specific protein

Protein name: reticulon 1

Full length: 776 amino acids

Entry name: RTN1_HUMAN

• SKU: ASBPP-4176-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4176-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6252