Recombinant Human RXRB Protein

Recombinant Human RXRB Protein
SKU
ASBPP-4405-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P28702

Gene Name: RXRB

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Cys191

End Site: Met270

Coverage: 0.16

Isoelectric Point: 9

Core Sequence: CPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: NR2B2

Alternative protein names: Retinoic acid receptor RXR-beta; Nuclear receptor subfamily 2 group B member 2; Retinoid X receptor beta

Protein name: retinoid X receptor beta

Full length: 533 amino acids

Entry name: RXRB_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4405-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4405-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6257
Product information (PDF)
×
MSDS (PDF)
×