Recombinant Human RYR2 Protein

Recombinant Human RYR2 Protein
SKU
ASBPP-4195-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92736

Gene Name: RYR2

Expression System: Escherichia coli

Molecular Weight: 38.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Leu3621

End Site: Leu3940

Coverage: 0.06

Isoelectric Point: 4.5

Core Sequence: LQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 96%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Ryanodine receptor 2; RYR-2; RyR2; hRYR-2; Cardiac muscle ryanodine receptor; Cardiac muscle ryanodine receptor-calcium release channel; Type 2 ryanodine receptor

Protein name: ryanodine receptor 2

Full length: 4967 amino acids

Entry name: RYR2_HUMAN
More Information
SKU ASBPP-4195-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4195-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6262
Product information (PDF)
×
MSDS (PDF)
×