Recombinant Human SAP30BP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHR5

Gene Name: SAP30BP

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asn161

End Site: Gly300

Coverage: 0.50

Isoelectric Point: 10

Core Sequence: NPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: HCNGP; HTRG; HTRP

Alternative protein names: SAP30-binding protein; Transcriptional regulator protein HCNGP

Protein name: SAP30 binding protein

Full length: 308 amino acids

Entry name: S30BP_HUMAN

• SKU: ASBPP-10488-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10488-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 29115