Recombinant Human SBK2 Protein

Recombinant Human SBK2 Protein
SKU
ASBPP-4213-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0C263

Gene Name: SBK2

Expression System: Escherichia coli

Molecular Weight: 37 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Glu21

End Site: Gly340

Coverage: 0.93

Isoelectric Point: 6.5

Core Sequence: EEGLGGLTLEELQQGQEAARALEDMMTLSAQTLVRAEVDELYEEVRPLGQGCYGRVLLVTHRQKGTPLALKQLPKPRTSLRGFLYEFCVGLSLGAHSAIVTAYGIGIESAHSYSFLTEPVLHGDLMAFIQPKVGLPQPAVHRCAAQLASALEYIHARGLVYRDLKPENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 85%, Cynomolgus monkey - 96%

Alternative gene names: SGK069

Alternative protein names: Serine/threonine-protein kinase SBK2; SH3 domain-binding kinase family member 2; Sugen kinase 69; SgK069

Protein name: SH3 domain binding kinase family member 2

Full length: 348 amino acids

Entry name: SBK2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4213-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4213-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 646643
Product information (PDF)
×
MSDS (PDF)
×