Recombinant Human SCN2A Protein

Recombinant Human SCN2A Protein
SKU
ASBPP-4175-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99250

Gene Name: SCN2A

Expression System: Escherichia coli

Molecular Weight: 27.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Val1781

End Site: Ile2000

Coverage: 0.11

Isoelectric Point: 5.5

Core Sequence: VATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: NAC2; SCN2A1; SCN2A2

Alternative protein names: Sodium channel protein type 2 subunit alpha; HBSC II; Sodium channel protein brain II subunit alpha; Sodium channel protein type II subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.2

Protein name: sodium voltage-gated channel alpha subunit 2

Full length: 2005 amino acids

Entry name: SCN2A_HUMAN
More Information
SKU ASBPP-4175-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4175-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6326
Product information (PDF)
×
MSDS (PDF)
×