Recombinant Human SEMG2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q02383

Gene Name: SEMG2

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Gly301

End Site: Val450

Coverage: 0.28

Isoelectric Point: 7.5

Core Sequence: GEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQSSSTEERHLNCGEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNSGEKDVQKGVSKGSISIQTEEKIHGKSQNQV

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Semenogelin-2; Semenogelin II; SGII

Protein name: semenogelin 2

Full length: 582 amino acids

Entry name: SEMG2_HUMAN

• SKU: ASBPP-4233-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4233-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6407