Recombinant Human SEPTIN4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NEP4

Gene Name: SEPTIN4

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ser101

End Site: Glu200

Coverage: 0.23

Isoelectric Point: 10.5

Core Sequence: SPHLKSQKTQTLASHASSRQWKVSPPREEAARRGSESKSGREVGHHASSIPDAKSTHQLSFQDQKNNLQSQILEDDPPSKVQNPQGVRVPRRILSYPKDE

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: /

Protein name: Septin-4 (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Peanut-like protein 2)

Full length: 570 amino acids

• SKU: ASBPP-3819-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3819-20
• Package Unit: 20 μg
• Quantity Unit: STK