Recombinant Human SEPTIN6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14141

Gene Name: SEPTIN6

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Thr311

End Site: Lys400

Coverage: 0.23

Isoelectric Point: 7

Core Sequence: TDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 62%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0128; SEP2; SEPT6

Alternative protein names: Septin-6

Protein name: septin 6

Full length: 434 amino acids

Entry name: SEPT6_HUMAN

• SKU: ASBPP-3886-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3886-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23157