Recombinant Human SFR1 Protein

Recombinant Human SFR1 Protein
SKU
ASBPP-10375-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86XK3

Gene Name: SFR1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Thr11

End Site: Leu170

Coverage: 0.68

Isoelectric Point: 6.5

Core Sequence: TFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 56%, Pig - 77%, Cynomolgus monkey - 93%

Alternative gene names: C10orf78; MEI5; MEIR5

Alternative protein names: Swi5-dependent recombination DNA repair protein 1 homolog; Meiosis protein 5 homolog

Protein name: SWI5 dependent homologous recombination repair protein 1

Full length: 245 amino acids

Entry name: SFR1_HUMAN
More Information
SKU ASBPP-10375-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10375-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 119392
Product information (PDF)
×
MSDS (PDF)
×