Recombinant Human SLAMF8 Protein

Recombinant Human SLAMF8 Protein
SKU
ASBPP-3279-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P0V8

Gene Name: SLAMF8

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Gln111

End Site: Ser230

Coverage: 0.47

Isoelectric Point: 6

Core Sequence: QPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 28%, Pig - 82%, Cynomolgus monkey - 94%

Alternative gene names: BLAME

Alternative protein names: SLAM family member 8; B-lymphocyte activator macrophage expressed; BCM-like membrane protein; CD antigen CD353

Protein name: SLAM family member 8

Full length: 285 amino acids

Entry name: SLAF8_HUMAN

CD Antigen: CD353

Product panel: CD Antigen
More Information
SKU ASBPP-3279-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3279-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 56833
Product information (PDF)
×
MSDS (PDF)
×