Recombinant Human SLC12A1 Protein

Recombinant Human SLC12A1 Protein
SKU
ASBPP-4216-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13621

Gene Name: SLC12A1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Leu11

End Site: Asp170

Coverage: 0.16

Isoelectric Point: 5

Core Sequence: LDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 82%, Pig - 85%, Cynomolgus monkey - 97%

Alternative gene names: NKCC2

Alternative protein names: Solute carrier family 12 member 1; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney-specific Na-K-Cl symporter

Protein name: solute carrier family 12 member 1

Full length: 1099 amino acids

Entry name: S12A1_HUMAN
More Information
SKU ASBPP-4216-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4216-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6557
Product information (PDF)
×
MSDS (PDF)
×