Recombinant Human SLC12A3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55017

Gene Name: SLC12A3

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Ile61

End Site: Pro130

Coverage: 0.07

Isoelectric Point: 6.5

Core Sequence: IDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEGEAGTSSEKNP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 84%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: NCC; TSC

Alternative protein names: Solute carrier family 12 member 3; Na-Cl cotransporter; NCC; Na-Cl symporter; Thiazide-sensitive sodium-chloride cotransporter

Protein name: solute carrier family 12 member 3

Full length: 1021 amino acids

Entry name: S12A3_HUMAN

• SKU: ASBPP-4218-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4218-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6559