Recombinant Human SLC13A1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BZW2

Gene Name: SLC13A1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Ala161

End Site: Thr230

Coverage: 0.14

Isoelectric Point: 8

Core Sequence: AEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 63%, Pig - 79%, Cynomolgus monkey - 92%

Alternative gene names: NAS1; NASI1

Alternative protein names: Solute carrier family 13 member 1; Renal sodium/sulfate cotransporter; Na(+)/sulfate cotransporter; hNaSi-1

Protein name: solute carrier family 13 member 1

Full length: 595 amino acids

Entry name: S13A1_HUMAN

• SKU: ASBPP-4221-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4221-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6561