Recombinant Human SLC13A1 Protein

Recombinant Human SLC13A1 Protein
SKU
ASBPP-4221-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BZW2

Gene Name: SLC13A1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Ala161

End Site: Thr230

Coverage: 0.14

Isoelectric Point: 8

Core Sequence: AEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 63%, Pig - 79%, Cynomolgus monkey - 92%

Alternative gene names: NAS1; NASI1

Alternative protein names: Solute carrier family 13 member 1; Renal sodium/sulfate cotransporter; Na(+)/sulfate cotransporter; hNaSi-1

Protein name: solute carrier family 13 member 1

Full length: 595 amino acids

Entry name: S13A1_HUMAN
More Information
SKU ASBPP-4221-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4221-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6561
Product information (PDF)
×
MSDS (PDF)
×