Note: Dry Ice fees will be extra-charged
Uniprot: Q9P2U8
Gene Name: SLC17A6
Expression System: Escherichia coli
Molecular Weight: 10.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 88%
Start Site: Glu501
End Site: Asp580
Coverage: 0.14
Isoelectric Point: 4.5
Core Sequence: EKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVD
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 89%, Pig - 93%, Cynomolgus monkey - 99%
Alternative gene names: DNPI; VGLUT2
Alternative protein names: Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6
Protein name: solute carrier family 17 member 6
Full length: 582 amino acids
Entry name: VGLU2_HUMAN
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers
English
Deutsch
