Recombinant Human SLC34A3 Protein

Recombinant Human SLC34A3 Protein
SKU
ASBPP-4224-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N130

Gene Name: SLC34A3

Expression System: Escherichia coli

Molecular Weight: 9.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Pro11

End Site: Ala70

Coverage: 0.12

Isoelectric Point: 7

Core Sequence: PHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 59%, Pig - 64%, Cynomolgus monkey - 92%

Alternative gene names: NPT2C; NPTIIC

Alternative protein names: Sodium-dependent phosphate transport protein 2C; Sodium-phosphate transport protein 2C; Na(+)-dependent phosphate cotransporter 2C; Sodium/inorganic phosphate cotransporter IIC; Sodium/phosphate cotransporter 2C; Na(+)/Pi cotransporter 2C; NaPi-2c; Solute carrier family 34 member 3

Protein name: solute carrier family 34 member 3

Full length: 599 amino acids

Entry name: NPT2C_HUMAN
More Information
SKU ASBPP-4224-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4224-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 142680
Product information (PDF)
×
MSDS (PDF)
×