Recombinant Human SLC4A3 Protein

Recombinant Human SLC4A3 Protein
SKU
ASBPP-302-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48751

Gene Name: SLC4A3

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: His201

End Site: Glu340

Coverage: 0.12

Isoelectric Point: 10.5

Core Sequence: HSSSSPSPRARASRLAGEKSRPWSPSASYDLRERLCPGSALGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRTQGGRGSPSGLAPILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: AE3

Alternative protein names: Anion exchange protein 3; AE 3; Anion exchanger 3; CAE3/BAE3; Cardiac/brain band 3-like protein; Neuronal band 3-like protein; Solute carrier family 4 member 3

Protein name: solute carrier family 4 member 3

Full length: 1232 amino acids

Entry name: B3A3_HUMAN
More Information
SKU ASBPP-302-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-302-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6508
Product information (PDF)
×
MSDS (PDF)
×