Recombinant Human SLC5A1 Protein

Recombinant Human SLC5A1 Protein
SKU
ASBPP-4265-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P13866

Gene Name: SLC5A1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Ile571

End Site: Leu640

Coverage: 0.12

Isoelectric Point: 6

Core Sequence: IDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 73%, Pig - 81%, Cynomolgus monkey - 91%

Alternative gene names: NAGT; SGLT1

Alternative protein names: Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1

Protein name: solute carrier family 5 member 1

Full length: 664 amino acids

Entry name: SC5A1_HUMAN
More Information
SKU ASBPP-4265-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4265-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6523
Product information (PDF)
×
MSDS (PDF)
×