Recombinant Human SLC5A2 Protein

Recombinant Human SLC5A2 Protein
SKU
ASBPP-4414-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P31639

Gene Name: SLC5A2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu571

End Site: Leu640

Coverage: 0.12

Isoelectric Point: 4.5

Core Sequence: EDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 71%, Pig - 74%, Cynomolgus monkey - 92%

Alternative gene names: SGLT2

Alternative protein names: Sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2

Protein name: solute carrier family 5 member 2

Full length: 672 amino acids

Entry name: SC5A2_HUMAN
More Information
SKU ASBPP-4414-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4414-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6524
Product information (PDF)
×
MSDS (PDF)
×