Recombinant Human SLC9A4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6AI14

Gene Name: SLC9A4

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 52%

Start Site: Arg671

End Site: Asp780

Coverage: 0.14

Isoelectric Point: 7

Core Sequence: RDTRAAGFSDDDSSDPGSPSITFSACSRIGSLQKQEAQEIIPMKSLHRGRKAFSFGYQRNTSQEEYLGGVRRVALRPKPLFHAVDEEGESGGESEGKASLVEVRSRWTAD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 52%, Pig - 55%, Cynomolgus monkey - 94%

Alternative gene names: NHE4

Alternative protein names: Sodium/hydrogen exchanger 4; Na(+)/H(+) exchanger 4; NHE-4; Solute carrier family 9 member 4

Protein name: solute carrier family 9 member A4

Full length: 798 amino acids

Entry name: SL9A4_HUMAN

• SKU: ASBPP-4279-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4279-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 389015