Recombinant Human SNAPIN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95295

Gene Name: SNAPIN

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Lys136

Coverage: 1.00

Isoelectric Point: 9

Core Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: BLOC1S7; SNAP25BP; SNAPAP

Alternative protein names: SNARE-associated protein Snapin; Biogenesis of lysosome-related organelles complex 1 subunit 7; BLOC-1 subunit 7; Synaptosomal-associated protein 25-binding protein; SNAP-associated protein

Protein name: SNAP associated protein

Full length: 136 amino acids

Entry name: SNAPN_HUMAN

• SKU: ASBPP-4088-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4088-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23557