Recombinant Human SNRNP27 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WVK2

Gene Name: SNRNP27

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Arg71

End Site: Pro150

Coverage: 0.54

Isoelectric Point: 9.5

Core Sequence: RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein; U4/U6.U5 snRNP 27 kDa protein; U4/U6.U5-27K; Nucleic acid-binding protein RY-1; U4/U6.U5 tri-snRNP-associated 27 kDa protein; 27K; U4/U6.U5 tri-snRNP-associated protein 3

Protein name: small nuclear ribonucleoprotein U4/U6.U5 subunit 27

Full length: 155 amino acids

Entry name: SNR27_HUMAN

• SKU: ASBPP-10477-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10477-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 11017