Recombinant Human SNX31 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N9S9

Gene Name: SNX31

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Asp111

End Site: Asn340

Coverage: 0.54

Isoelectric Point: 6

Core Sequence: DIATKKAYLDIFLPNEQSIRIEIITSDTAERVLEVVSHKIGLCRELLGYFGLFLIRFGKEGKLSVVKKLADFELPYVSLGSSEVENCKVGLRKWYMAPSLDSVLMDCRVAVDLLYMQAIQDIEKGWAKPTQAQRQKLEAFQKEDSQTKFLELAREVRHYGYLQLDPCTCDYPESGSGAVLSVGNNEISCCITLPDSQTQDIVFQMSRVKCWQVTFLGTLLDTDGPQRTLN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 40%, Pig - 82%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Sorting nexin-31

Protein name: sorting nexin 31

Full length: 440 amino acids

Entry name: SNX31_HUMAN

• SKU: ASBPP-3835-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3835-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 169166