Recombinant Human SOAT1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35610

Gene Name: SOAT1

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Asn11

End Site: Lys120

Coverage: 0.23

Isoelectric Point: 7

Core Sequence: NRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 77%, Pig - 82%, Cynomolgus monkey - 98%

Alternative gene names: ACACT; ACACT1; ACAT; ACAT1; SOAT; STAT

Alternative protein names: Sterol O-acyltransferase 1; Acyl-coenzyme A:cholesterol acyltransferase 1; ACAT-1; Cholesterol acyltransferase 1

Protein name: sterol O-acyltransferase 1

Full length: 550 amino acids

Entry name: SOAT1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4424-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4424-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6646