Recombinant Human SOX4 Protein

Recombinant Human SOX4 Protein
SKU
ASBPP-394-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q06945

Gene Name: SOX4

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Lys91

End Site: Gly170

Coverage: 0.18

Isoelectric Point: 11

Core Sequence: KRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 82%, Pig - 99%, Cynomolgus monkey - 62%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-4

Protein name: SRY-box transcription factor 4

Full length: 474 amino acids

Entry name: SOX4_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin
More Information
SKU ASBPP-394-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-394-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6659
Product information (PDF)
×
MSDS (PDF)
×