Recombinant Human SOX7 Protein

Recombinant Human SOX7 Protein
SKU
ASBPP-372-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BT81

Gene Name: SOX7

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala51

End Site: Asp130

Coverage: 0.22

Isoelectric Point: 11

Core Sequence: AFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 67%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-7

Protein name: SRY-box transcription factor 7

Full length: 388 amino acids

Entry name: SOX7_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin
More Information
SKU ASBPP-372-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-372-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 83595
Product information (PDF)
×
MSDS (PDF)
×