Recombinant Human SOX7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BT81

Gene Name: SOX7

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala51

End Site: Asp130

Coverage: 0.22

Isoelectric Point: 11

Core Sequence: AFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 67%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-7

Protein name: SRY-box transcription factor 7

Full length: 388 amino acids

Entry name: SOX7_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin

• SKU: ASBPP-372-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-372-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 83595