Recombinant Human SPR Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35270

Gene Name: SPR

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Met1

End Site: Lys261

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 75%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Sepiapterin reductase; SPR

Protein name: sepiapterin reductase

Full length: 261 amino acids

Entry name: SPRE_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3944-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3944-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6697