Recombinant Human SPRR3 Protein

Recombinant Human SPRR3 Protein
SKU
ASBPP-4054-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBC9

Gene Name: SPRR3

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Met1

End Site: Lys169

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Rat - 56%, Pig - 49%, Cynomolgus monkey - 86%

Alternative gene names: SPRC

Alternative protein names: Small proline-rich protein 3; 22 kDa pancornulin; Cornifin beta; Esophagin

Protein name: small proline rich protein 3

Full length: 169 amino acids

Entry name: SPRR3_HUMAN
More Information
SKU ASBPP-4054-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4054-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6707
Product information (PDF)
×
MSDS (PDF)
×