Recombinant Human alpha 1 Spectrin Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P02549

Gene Name: SPTA1

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu11

End Site: Lys150

Coverage: 0.06

Isoelectric Point: 6

Core Sequence: ESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 53%, Pig - 73%, Cynomolgus monkey - 94%

Alternative gene names: SPTA

Alternative protein names: Spectrin alpha chain; erythrocytic 1; Erythroid alpha-spectrin

Protein name: spectrin alpha, erythrocytic 1

Full length: 2419 amino acids

Entry name: SPTA1_HUMAN

• SKU: ASBPP-4167-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4167-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6708