Recombinant Human SSTR3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P32745

Gene Name: SSTR3

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Lys321

End Site: Ser410

Coverage: 0.24

Isoelectric Point: 7

Core Sequence: KQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 66%, Pig - 71%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Somatostatin receptor type 3; SS-3-R; SS3-R; SS3R; SST3; SSR-28

Protein name: somatostatin receptor 3

Full length: 418 amino acids

Entry name: SSR3_HUMAN

• SKU: ASBPP-4416-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4416-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6753