Note: Dry Ice fees will be extra-charged
Uniprot: Q9Y274
Gene Name: ST3GAL6
Expression System: Escherichia coli
Molecular Weight: 17 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 76%
Start Site: Lys71
End Site: Gly210
Coverage: 0.42
Isoelectric Point: 7
Core Sequence: KIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 90%, Cynomolgus monkey - 100%
Alternative gene names: SIAT10
Alternative protein names: Type 2 lactosamine alpha-2; 3-sialyltransferase; CMP-NeuAc:beta-galactoside alpha-2; 3-sialyltransferase VI; ST3Gal VI; ST3GalVI; Sialyltransferase 10
Protein name: ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Full length: 331 amino acids
Entry name: SIA10_HUMAN
Product panel: Enzyme
English
Deutsch
