Recombinant Human STT3A Protein

Recombinant Human STT3A Protein
SKU
ASBPP-3021-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P46977

Gene Name: STT3A

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Leu541

End Site: Arg700

Coverage: 0.23

Isoelectric Point: 6.5

Core Sequence: LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: ITM1; TMC

Alternative protein names: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; Oligosaccharyl transferase subunit STT3A; STT3-A; B5; Integral membrane protein 1; Transmembrane protein TMC

Protein name: STT3 oligosaccharyltransferase complex catalytic subunit A

Full length: 705 amino acids

Entry name: STT3A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3021-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3021-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3703
Product information (PDF)
×
MSDS (PDF)
×