Recombinant Human TAX1BP3 Protein

Recombinant Human TAX1BP3 Protein
SKU
ASBPP-4116-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14907

Gene Name: TAX1BP3

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Ser124

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 79%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: TIP1

Alternative protein names: Tax1-binding protein 3; Glutaminase-interacting protein 3; Tax interaction protein 1; TIP-1; Tax-interacting protein 1

Protein name: Tax1 binding protein 3

Full length: 124 amino acids

Entry name: TX1B3_HUMAN
More Information
SKU ASBPP-4116-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4116-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 30851
Product information (PDF)
×
MSDS (PDF)
×